PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g33980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 243aa    MW: 27245.8 Da    PI: 7.9899
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g33980genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.37.6e-17171205135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                C +Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  Tp7g33980 171 CCHCGVQKTPQWRMGPLGAKTLCNACGVRFKSGRL 205
                99*****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169928.3E-872241IPR016679Transcription factor, GATA, plant
SuperFamilySSF577168.55E-13165227No hitNo description
PROSITE profilePS5011411.279165201IPR000679Zinc finger, GATA-type
SMARTSM004014.3E-11165219IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.1E-12169203IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440171196IPR000679Zinc finger, GATA-type
CDDcd002022.06E-13171227No hitNo description
PfamPF003201.3E-14171205IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MEFVETFLGD FSVDDLLDLS NADAFIREKS SLSPREEDEQ EREKANSFSD QITRISPLED  60
LLSFPRSKLD IPVGDLEDLE WLSNFVEESF SESYLSGEFP VTSAASVEVQ RQCVPVKPRS  120
KRRRITGHIW SLDSPYSSLS TAGSSGLRKR GRKKAETSSV AGVQQQPRRC CCHCGVQKTP  180
QWRMGPLGAK TLCNACGVRF KSGRLLPEYR PACSPTFSTE IHSNSHRKVL ELRLMKTADP  240
GRV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120124KRRRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013599276.11e-134PREDICTED: GATA transcription factor 7
SwissprotO655151e-127GATA7_ARATH; GATA transcription factor 7
TrEMBLA0A0D3A1J91e-134A0A0D3A1J9_BRAOL; Uncharacterized protein
STRINGBra011673.1-P1e-131(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM146541720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-128GATA transcription factor 7